Protein Info for CA264_09195 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 661 TIGR00229: PAS domain S-box protein" amino acids 58 to 181 (124 residues), 47.7 bits, see alignment E=8.1e-17 amino acids 326 to 445 (120 residues), 52.1 bits, see alignment E=3.6e-18 PF00989: PAS" amino acids 62 to 171 (110 residues), 31.4 bits, see alignment E=6e-11 amino acids 330 to 436 (107 residues), 46.8 bits, see alignment E=9.5e-16 PF08448: PAS_4" amino acids 67 to 175 (109 residues), 46.8 bits, see alignment E=1.1e-15 amino acids 208 to 297 (90 residues), 27.6 bits, see alignment E=1e-09 amino acids 336 to 439 (104 residues), 46.2 bits, see alignment E=1.8e-15 PF13426: PAS_9" amino acids 79 to 173 (95 residues), 27 bits, see alignment E=1.6e-09 amino acids 346 to 438 (93 residues), 24.6 bits, see alignment E=9e-09 PF07730: HisKA_3" amino acids 469 to 530 (62 residues), 32 bits, see alignment E=5.3e-11 PF02518: HATPase_c" amino acids 571 to 661 (91 residues), 50.3 bits, see alignment E=1e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRT1 at UniProt or InterPro

Protein Sequence (661 amino acids)

>CA264_09195 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKNDLRSCLQQVSHEQAAPVSESLEKQLLQKNKELLELNQRLLQEIEERKRVEQSLLQSE
RKYRKVVESSSDIIGRFDKNLRHIFVNDAVEAAFGLPKQQLIGKSHQELNLPEYVLRETR
DRIQEVFRTGQKETSITYLPTPEGLRCFHSVIEPELSEAGTVETVVAIGRDLTMEALKEQ
MLNSVFDNTRIGITSLHAVRDEQGHIVDFEWMLANKSAAAILGQSSSELINKRILSLFPG
IKATGLFDFMVQVVEQGGAHSQSLFYNHEHLNAWFDLLISKLADGVILTFVDISEQRKTA
LALKHTNQELLQEVQERKTAERRLQQEHELLERIIEHSVDCICAFDERGYYTAWNRMMEV
YTGFKREQVLGRHIFDVHPHLKDTKVAQKVKQVLQGRSCRLKAVPFMQRPGSYELNLVPT
FDAEQQQTGGIIFMRDLAESLKLKEMTIQHRLSQQKNNLQVVLQTQEEERKRIAEALHNG
LGQLLYGIKLHLEQAKGAGTGAVARIQEIALLLEEAITETRTISFELMPSILQDFGLEVA
LQEFCKKLSRTHITINLKEYNAAARFDANLEIAVYRMVQELVNNCIKHAGATLVEIEVVQ
AKGKLRLQVRDNGKGADTAKLKKCDGIGLRSIRNRLKLLNGRLRINAEAGKGTAVTLQVP
L