Protein Info for CA264_09125 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glucose/galactose MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 336 to 353 (18 residues), see Phobius details amino acids 360 to 377 (18 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details amino acids 443 to 462 (20 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 346 (312 residues), 39.7 bits, see alignment E=1.5e-14 TIGR01272: glucose/galactose transporter WARNING" amino acids 115 to 346 (232 residues), 211.1 bits, see alignment E=1.3e-66

Best Hits

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 57% identity to phe:Phep_2311)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRT6 at UniProt or InterPro

Protein Sequence (472 amino acids)

>CA264_09125 glucose/galactose MFS transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MAGTTHTDVNAAKAASGNAVTKKYTGPLITVTMLFFMWGFITCLNDILIPKLQQVFTLEL
WQAMLIQTAFFGAYFFISLLYFIMSITKGDPIRKIGYKNGIIVGLVIAAVGCALFYPAAD
LHSYGFFLGALFILASGITVLQIAANPYVTILGPPESAASRLNMTQALNSLGTTVAPIIG
GYLIFGAVNAESAGADSVKLPYLGLAATLLAIAVLIKIAKLPSIQSEDDITPDAGALRYR
HLVLGIVCIFAYVGGEVAIGSTLINFFRLPEIAGLDETQAGHFLAFYWGGAMVGRFFGAV
ALSSMKNSTFKYLIIAGIAAVVFVIISSVYSMDEALITLGLIALNFVVLMLGRFIPNRTL
GLFAGTVVVLLLITSFATGSVAMWAVIAIGLFNSIMFPTIFTLAIKDLGVHTSQGSSLLV
MAIVGGAIIPPLQGAIADATGNLQLSFLVPMVCYLYIMYYGFSGSKVKEPAA