Protein Info for CA264_09085 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sugar hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR01180: putative alpha-1,2-mannosidase" amino acids 8 to 764 (757 residues), 685.7 bits, see alignment E=3.4e-210 PF17678: Glyco_hydro_92N" amino acids 29 to 289 (261 residues), 277.9 bits, see alignment E=9e-87 PF07971: Glyco_hydro_92" amino acids 296 to 760 (465 residues), 632.2 bits, see alignment E=6.3e-194

Best Hits

KEGG orthology group: None (inferred from 75% identity to fjo:Fjoh_2358)

Predicted SEED Role

"Alpha-1,2-mannosidase" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRR2 at UniProt or InterPro

Protein Sequence (771 amino acids)

>CA264_09085 sugar hydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKTILSALLLIPAVLAAQSNSPRDLVQYVNPMIGTAKMGHTYPGATAPFGMVQLSPDTD
TIPYAMDGKYNKDVYKYCAGYQYDDPTIVGFSHTHFSGTGHSDLGDFLLMPTTGKLQLNP
GTEKKPESGYRSAFSHQNEKAEPAYYKVKLDDHNITAELTATNRVGMHQYTFPKAEEAHV
ILDLMHGIYNYDGKNVWTFVRVENDTLVTGYRQTNGWARTRTVYFAMSFSKPIKSYGNKD
FSEPQVYKGFWRKFDQEKNFPEFAGTKLRAYFDFDVQEGEKLQVKFALSPVSTEGALANM
RAEVPGWDFEQVKQQSQALWNKELNKIQVKALKQEDLVNFYTAMYHTFLGPTTYMDVDGN
YRGLDQNIHKADGFTNYTTFSLWDTYRALHPFFNIVQPKRNADMVQSMLAHYDQSVHKML
PVWSHHANENWCMIGYHSVPVIADAVIKGNAGFDVERALDACVATAKTRYYDGLDYYMDL
GYVPEDKNGSSVSKTLEYAYDDWCIAQMAKKLNRPDVYEEFMQRAQNYRNVYDARTGYMR
PKLSDGSWKKEFDPLDTHGQGFIEGNSWNYSLYVPHDPAQMISMMGGKQRFAQHLDSLFT
MELPDKYFANTEDISRDGIIGNYVHGNEPSHHVAYLYNWTDEPWKTQERTRMILKAMYKP
TVDGLGGNDDCGQMSAWYIFSTLGFYPVAPGSEQYAIGSPAIKEASIHLENGKTFTIRTK
SQSDKNVYVQKIELNGKPLNRSYLTHTELVNGGDLVFYMGAKPNRKQVSMR