Protein Info for CA264_09020 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF20434: BD-FAE" amino acids 26 to 221 (196 residues), 126.9 bits, see alignment E=5.9e-40 PF00756: Esterase" amino acids 28 to 127 (100 residues), 25.1 bits, see alignment E=9.5e-09 PF00561: Abhydrolase_1" amino acids 32 to 163 (132 residues), 30.6 bits, see alignment E=1.9e-10 PF07859: Abhydrolase_3" amino acids 34 to 239 (206 residues), 41.7 bits, see alignment E=8.5e-14 PF12697: Abhydrolase_6" amino acids 34 to 243 (210 residues), 43.6 bits, see alignment E=4e-14 PF03959: FSH1" amino acids 82 to 239 (158 residues), 28.2 bits, see alignment E=1e-09 PF00326: Peptidase_S9" amino acids 83 to 239 (157 residues), 54 bits, see alignment E=1.2e-17 PF06821: Ser_hydrolase" amino acids 91 to 257 (167 residues), 27.4 bits, see alignment E=2.1e-09 PF08840: BAAT_C" amino acids 103 to 258 (156 residues), 23.5 bits, see alignment E=4e-08

Best Hits

KEGG orthology group: None (inferred from 55% identity to hau:Haur_0331)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYI2 at UniProt or InterPro

Protein Sequence (261 amino acids)

>CA264_09020 alpha/beta hydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MPVPAADHIIKYGPDALQFGELRLPEGKGEFPVVVVVHGGCWLNEYNLEYMSHLSEELTK
AGYATWNIEFRRVGDVGGGWPGTFQDVALATDYVRELAKSYPIDAKRVAVIGHSAGGHLA
LWLAARHHLPKSSSLYAKKPLKLKGVISLAGIADLETYSQQEGSCNAAVPQLMGGSPTDF
PERYAQASPQQMLPLQVPSRLVQGKRDPIVPVAQAENFAQKAKAAGDNAQVVLLPDAGHF
DLVAPSSPAWPQVLKAVQELL