Protein Info for CA264_08990 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: FeS-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 112 to 132 (21 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 201 to 218 (18 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 278 to 307 (30 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details PF12801: Fer4_5" amino acids 294 to 331 (38 residues), 29 bits, see alignment 2.5e-10 amino acids 393 to 434 (42 residues), 17.7 bits, see alignment 8.3e-07 PF13187: Fer4_9" amino acids 440 to 486 (47 residues), 31 bits, see alignment 6.4e-11 PF00037: Fer4" amino acids 470 to 487 (18 residues), 23.5 bits, see alignment (E = 1.1e-08)

Best Hits

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRS4 at UniProt or InterPro

Protein Sequence (514 amino acids)

>CA264_08990 FeS-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKITQKIGLGVFLLCLLLFNALLFMGQFELTAQQLEQTIKQEHVAVLKQELQPMLGKTYS
SSFAFATDFNQYLDNYNEEQQRSQQWDRVIWDDYVFALTKVASQGFVQSNKLLLLFLTVV
LGAAGALLYILPKHRGEPAGVRNNGVMFSSNKSRGWVGITLGVYLTAVYILLYWYPEYLV
NWTMLVDPLSRALSGGPASQWFLYGTLYTLAILVMGVRMFRKYKGNAYQLVRTSSVMFFQ
LSFAFLIPEILVLLNKPWQDLKNIWPLDYDFYFDYSVASMLGGGAVGMFMLIWGTLLALV
GVPVFTYLYGKRWYCSWVCGCGGLAETAGDPYRHLSDKSLKAWKVERWLVYPILVIIVVI
TVMTIANYFTDFALLEEYTNVLHQWYGFLIGAAFAGVIGVGFYPLMGNRVWCRYGCPLAA
YIGIVQRFKSRFRITTNGGQCISCGNCSAYCEMGIDVRWYAQRGQNVVRASCVGCGICAT
VCPRGVLKLENGPEQGRITDIPILTGNDSIKVLH