Protein Info for CA264_08985 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glycosyl transferase family 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 309 to 330 (22 residues), see Phobius details amino acids 337 to 360 (24 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details amino acids 439 to 458 (20 residues), see Phobius details amino acids 464 to 483 (20 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 53 to 279 (227 residues), 92.8 bits, see alignment E=6.1e-30 PF00535: Glycos_transf_2" amino acids 56 to 221 (166 residues), 73.6 bits, see alignment E=3.9e-24 PF13506: Glyco_transf_21" amino acids 125 to 279 (155 residues), 31.2 bits, see alignment E=3e-11 PF13632: Glyco_trans_2_3" amino acids 140 to 336 (197 residues), 72.2 bits, see alignment E=1.1e-23

Best Hits

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRU4 at UniProt or InterPro

Protein Sequence (489 amino acids)

>CA264_08985 glycosyl transferase family 2 (Pontibacter actiniarum KMM 6156, DSM 19842)
MKVLIILCLLLYAAAMLFILLYSLAQAHLLYRFRRYLKQGSNATPPAPEVWPMVTVQLPV
YNEKYVVERLIDTVAALDYPAAKIEFQLLDDSDDETTQIIQQSIQQYPHLPFRHIRRQDR
SGFKAGALRYGLEQAKGEFIAIFDADFTPSPTFLKQTVPHFSHPETGMVQTRWAHLNKGY
SILTRLQAFALDAHFYIEQVGRSSLNAYINFNGTAGIWRKATILDAGNWQDDTLTEDLDL
SYRAQLKGWRFKYLPEVESPAELPPVMSALKSQQFRWTKGGAESAVKHLGSVLRSRAPLQ
TKCHATAHLLNSSVFVAVLLASLASIPLLWAKVNNLLPLVVFNAGAVTLLSFAVISLVYF
QANAMGNVSQSKRTGGFLLYFPLFLSISMGLALHNAVAVWEGWSGRKSPFIRTPKFNLEA
RQHKWQENFYLNIRMPYTTYAEGLLGLLFLGVAVWGIVQQEYGMLVFHGMLALGYLLVFY
HSYQSYRKI