Protein Info for CA264_08950 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: short-chain dehydrogenase/reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00106: adh_short" amino acids 4 to 190 (187 residues), 179.7 bits, see alignment E=9.4e-57 PF01370: Epimerase" amino acids 7 to 140 (134 residues), 22.4 bits, see alignment E=1.5e-08 PF08659: KR" amino acids 7 to 166 (160 residues), 36.5 bits, see alignment E=9.8e-13 PF13561: adh_short_C2" amino acids 10 to 201 (192 residues), 144.8 bits, see alignment E=6.9e-46

Best Hits

KEGG orthology group: None (inferred from 52% identity to hhy:Halhy_6838)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRQ6 at UniProt or InterPro

Protein Sequence (278 amino acids)

>CA264_08950 short-chain dehydrogenase/reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAEKIWFITGVSSGFGRTLAEEVARRGDKVIGTVRQHRQLEEFNAISPGNTFAYMMDVTN
ADGVRATVDAAVKHLGRLDVLVNNAGFGFLGAVEEASVQEFREVMETNFFGALQVTQAVL
PHMRRQGSGHIIQMSSVAGFRSTQGFGVYNASKFALEGMSEALAQEVAPLGIRVSIIEPG
PFRTNFAGSSIKGAKQELPEYEGTARVFKNNILGYAGEQEGDPVKAAQVLLQVVDSDNPP
LRLPLGQTAYDGVRRKLQQVEQDLQNWEHTATKTSFND