Protein Info for CA264_08925 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 23S rRNA pseudouridine synthase F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF01479: S4" amino acids 5 to 49 (45 residues), 42.8 bits, see alignment 3.4e-15 PF00849: PseudoU_synth_2" amino acids 65 to 191 (127 residues), 73.4 bits, see alignment E=2.4e-24 TIGR00093: pseudouridine synthase" amino acids 69 to 222 (154 residues), 153.4 bits, see alignment E=2.2e-49

Best Hits

Swiss-Prot: 52% identical to RLUF_ECOL6: 23S rRNA pseudouridine(2604) synthase (rluF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06182, ribosomal large subunit pseudouridine synthase F [EC: 5.4.99.12] (inferred from 48% identity to asa:ASA_2730)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase F (EC 4.2.1.70)" (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRN4 at UniProt or InterPro

Protein Sequence (328 amino acids)

>CA264_08925 23S rRNA pseudouridine synthase F (Pontibacter actiniarum KMM 6156, DSM 19842)
MEPIRLNKFISDSGYCSRREADKMIEQGRVMVNGKRPDVGAKVTAKDKVRVDGNLLEVNA
VEPVYLLLNKPAGIETTTDTSQRDNIISFTNYPERIFPVGRLDKDSEGLIILTNDGDIVN
KILRAGNRHEKEYVVTVDRPINQDFVEKMSGGVSILGVNTKKCFVAQEGPNKFRIILTQG
MNRQIRRMCEALGYEVQTLQRTRIMHLSLNKIPLGQWRNMTEPEVAELLRLVAGSTKTEE
GSVGKKRAAEASAPAKSNKPKPRTGGSAAGKSTRAGGPKGGKSTAGGKRDKPKSQSSARG
SRGASKGSPKGAAGGKGRSGAARGGKRR