Protein Info for CA264_08885 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 35% identical to RGN_XENLA: Regucalcin (rgn) from Xenopus laevis

KEGG orthology group: None (inferred from 41% identity to spu:576326)

Predicted SEED Role

"Gluconolactonase (EC 3.1.1.17)" in subsystem Entner-Doudoroff Pathway (EC 3.1.1.17)

MetaCyc Pathways

Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
sorbitol biosynthesis II (2/3 steps found)
glucose and glucose-1-phosphate degradation (3/5 steps found)
L-ascorbate biosynthesis IV (animals, D-glucuronate pathway) (3/6 steps found)
Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
L-ascorbate biosynthesis VI (plants, myo-inositol pathway) (1/4 steps found)
glucose degradation (oxidative) (1/5 steps found)
L-ascorbate biosynthesis VIII (engineered pathway) (2/7 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRQ1 at UniProt or InterPro

Protein Sequence (313 amino acids)

>CA264_08885 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MVSSHFHTGALTKKSTLPTHDPLIASTVAGTQSRLGEGPCWHPQEQVLYWVDIEGQALRK
YSPGTKEVVAYPMPERVNAVVPMAGGGLLLALHNRVCSYNTATGEIGTLARPLTDASIRL
NDGKCDPCGRFWVGTMALDVRAGAAALYCVQQNLQVTLALQHLTISNGLAWSKNGDTFYF
TDSPTRTVQAFDFDLAAGSIRNPRVVVRVPEQEGMPDGLDIDVNGNLWIALHGSAAVACF
NPDTGEQLQRVEVEAINVTSCTFGGPNLDTLYITTAREWLPEEQLEKYPLSGSVFEVKPG
VKGREVNFFRPSV