Protein Info for CA264_08870 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 42% identical to HUTI_BACCN: Imidazolonepropionase (hutI) from Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 58% identity to cpi:Cpin_2008)

MetaCyc: 40% identical to imidazolone-5-propionate hydrolase (Bacillus subtilis)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

L-histidine degradation VI (7/8 steps found)
L-histidine degradation I (4/4 steps found)
L-histidine degradation III (4/6 steps found)
L-histidine degradation II (3/5 steps found)

KEGG Metabolic Maps

Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYA2 at UniProt or InterPro

Protein Sequence (417 amino acids)

>CA264_08870 imidazolonepropionase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKTMTNQTTLIGPFSQLLPMAELPKAGPIQDEQLQVLERAGVLVKGEQIVKIGNYDQLHH
EAVEQKYELQFIQEPMVLLPGLIDAHTHICFGGSRANDYAMRVAGKSYLEIARSGGGILD
SVRKTREATLVELVTLLKERCSRHLQEGVTTCEVKSGYGLTVEEELKMLEAIQLVNKHHK
LDLVPTCLAAHMLPPEHADARLYLQEVLTELLPQVQEQGLAKRVDIFVEETAFKEEEALE
FLLAAKEMGFEVTVHADQFSTSGSRVAAEAGAVSADHLEASGEEEIELLREAGVVATVLP
GASLGLGMHYAAARKMLDGGLCLAIATDWNPGSAPMGDLLMQAAVLGAAQKLTTAETLAA
ITTRAATALKLTDRGCLAKGKLADMIAFPTSNFKEILYLQGKLKPGKVWKRGKAVAV