Protein Info for CA264_08825 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 53% identical to Y3380_VIBCH: Putative esterase VC_A0580 (VC_A0580) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 60% identity to mtt:Ftrac_1128)

MetaCyc: 47% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]

Predicted SEED Role

No annotation

MetaCyc Pathways

superpathway of menaquinol-8 biosynthesis I (9/10 steps found)
superpathway of demethylmenaquinol-8 biosynthesis I (8/9 steps found)
2-carboxy-1,4-naphthoquinol biosynthesis (6/7 steps found)
superpathway of menaquinol-10 biosynthesis (8/10 steps found)
superpathway of menaquinol-11 biosynthesis (8/10 steps found)
superpathway of menaquinol-12 biosynthesis (8/10 steps found)
superpathway of menaquinol-13 biosynthesis (8/10 steps found)
superpathway of menaquinol-6 biosynthesis (8/10 steps found)
superpathway of menaquinol-7 biosynthesis (8/10 steps found)
superpathway of menaquinol-9 biosynthesis (8/10 steps found)
superpathway of demethylmenaquinol-6 biosynthesis I (7/9 steps found)
superpathway of demethylmenaquinol-9 biosynthesis (7/9 steps found)
superpathway of chorismate metabolism (39/59 steps found)
superpathway of phylloquinol biosynthesis (7/15 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRR3 at UniProt or InterPro

Protein Sequence (139 amino acids)

>CA264_08825 thioesterase (Pontibacter actiniarum KMM 6156, DSM 19842)
MDKNTDTVERVKQWCQNTMIEHLGIEITEAGPDFLCGRMPVDQRTHQPMGLLHGGASVVL
AESLASMGAALQVDLTKKACVGLEINANHLRGISTGWVYGKATPLHVGRSTQVWETKITN
EAGDLICISRMTVAVIDKK