Protein Info for CA264_08815 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 PF00364: Biotin_lipoyl" amino acids 4 to 76 (73 residues), 70.9 bits, see alignment E=2e-23 amino acids 134 to 206 (73 residues), 72.3 bits, see alignment E=6.9e-24 TIGR01349: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase" amino acids 135 to 558 (424 residues), 495.2 bits, see alignment E=1e-152 PF02817: E3_binding" amino acids 270 to 305 (36 residues), 52.4 bits, see alignment 1.4e-17 PF00198: 2-oxoacid_dh" amino acids 334 to 557 (224 residues), 300.5 bits, see alignment E=2.3e-93

Best Hits

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 65% identity to mtt:Ftrac_0743)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRM9 at UniProt or InterPro

Protein Sequence (558 amino acids)

>CA264_08815 pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAEVIRMPKMSDTMTEGVIASWLKKEGDKVSSGDILAEVETDKATMELESYEDGTLLYIG
PKKGDSVPVDALIAIIGKEGEDISGLLNDAKGGNGKPAAKEEKPEEKKEETKAAPAPQEA
PAKVADVSNIKASVIRMPKMSDTMTEGVLVSWQKKEGDKVKSGDILAEVETDKATMELES
YEDGTLLYIGVNEGDSVAVDAIIAIIGEEGADYKALLSAASSNKQSRQENAKTDEAIEES
VDAVTSEKVEETKVTDTATESNEASENGRIKASPLAKRVAKEKGYNLSQIKGSGENGRIV
LRDVENFTPSAAPQKAAAPQAAPAAAIPGAPAEAYEEVNVSQMRKVIARRLAESKFSAPH
FYLTMEIDMDKAIEARASINEVSPVKVSFNDLVIKAAAAALRQHPAVNSSWLGDKIRYNK
HINIGVAVAVEEGLLVPVVRNADFKSLSAISAEVKDLGGKAKSKKLQPSDWEGNTFTISN
LGMFGIEEFTAIINPPDACIMAVGGIKQTPVVRNGEIKIGNVMKVTLSCDHRVVDGAVGS
AFLQTFKNLLENPVRILV