Protein Info for CA264_08800 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: kinase inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02682: CT_C_D
  • amino acids 13 to 218 (206 residues), 249 bits, E=1.7e-78
• TIGR00370: sensor histidine kinase inhibitor, KipI family
  • amino acids 16 to 227 (212 residues), 255.4 bits, E=1.5e-80

Best Hits

Swiss-Prot: 52% identical to PXPB_BACSU: 5-oxoprolinase subunit B (pxpB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 55% identity to bmq:BMQ_0959)

Predicted SEED Role

"Allophanate hydrolase 2 subunit 1 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

• L-citrulline degradation (3/3 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• cyanate degradation (2/3 steps found)
• urea degradation I (2/3 steps found)
• cyanuric acid degradation II (3/5 steps found)
• uracil degradation III (3/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of allantoin degradation in yeast (2/6 steps found)
• superpathway of atrazine degradation (3/8 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54

Sequence Analysis Tools

See A0A1X9YRL3 at UniProt or InterPro

Protein Sequence (242 amino acids)

>CA264_08800 kinase inhibitor (Pontibacter actiniarum KMM 6156, DSM 19842)
MPEIIQNPPLLICPRGESAVELQFGSIISKKILNRIRAIAQVLDEQPFPGLVEYVPAFTT
LTVYYDPWVISQQGKLDAYEELTQKLEVLVEQVQETRSTPARVVELPVVYGGAYGPDLQE
VALHTGLREEEIIDMHSAGEYLVHMVGFAPGFPYLGGMDNRLATPRKATPSARIPAGSVG
IAGAQTGVYPISTPGGWQLIGRTPVALFNAARQVPSLLQAGDKVRFVPISEKEYEERKEG
QE