Protein Info for CA264_08790 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: LamB/YcsF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03746: LamB_YcsF
  • amino acids 6 to 243 (238 residues), 358.2 bits, E=1.1e-111

Best Hits

Swiss-Prot: 67% identical to PXPA_BREBN: 5-oxoprolinase subunit A (pxpA) from Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)

KEGG orthology group: K07160, UPF0271 protein (inferred from 67% identity to bbe:BBR47_26550)

MetaCyc: 53% identical to 5-oxoprolinase component A (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Lactam utilization protein LamB"

MetaCyc Pathways

• 5-oxo-L-proline metabolism (4/6 steps found)
• γ-glutamyl cycle (3/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.9

Sequence Analysis Tools

See A0A1X9YRQ9 at UniProt or InterPro

Protein Sequence (253 amino acids)

>CA264_08790 LamB/YcsF family protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MNQYTVDLNCDMGESYGAWRMGNDSELLNYVTSANIACGYHAGDPSTMKKTVRLALEKGV
AMGAHPGLPDLSGFGRREMAVSAEEVYDMVLYQAGALAAFAKAEGTRLHHLKPHGALYNM
AATNVELAQAIAEAVYKLDPELILYGLAGSELVKAGEKLGLQTASEVFADRTYQQDGSLT
PRRHPNALIVDQEEAVRQVVRMVKEGKVLSQQGDEVPVKADTVCVHGDGPHARAFAQLIR
ERLLAEGINLTAR