Protein Info for CA264_08785 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 267 to 291 (25 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 329 to 353 (25 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details PF01566: Nramp" amino acids 42 to 362 (321 residues), 63.5 bits, see alignment E=9.1e-22

Best Hits

Swiss-Prot: 66% identical to YCSG_BACSU: Uncharacterized membrane protein YcsG (ycsG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 76% identity to bmd:BMD_0963)

Predicted SEED Role

"Mn2+/Fe2+ transporter, NRAMP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRP1 at UniProt or InterPro

Protein Sequence (396 amino acids)

>CA264_08785 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKRNWSVLLGAAFLMATSAVGPGFLTQTTVFTQQLAASFGFVILISIVLDIGVQLNVWR
VIAVSERRAQDIANMVLPGLGAFISFLIVLGGLAFNIGNVGGAGLGFNVLLGVSPEVGAV
MAAAMAVAVFLVHEAGKVMDRFAQVLGFLMILLIVFVAFTSAPPVGVALTKSFFPDEVDV
LAIITLVGGTVGGYITFAGGHRLLDAGIKGKESLPEVNASAVSGITVASIIRIFLFLAAL
GVVSKGLVLDPANPPASVFQLSAGVIGYKLFGVVMLSAAVTSVIGSAYTSVSFLKSFSRK
IQAYENGVIIVFILVSTVIFVTIGQPVRLLILAGALNGLVLPLTLGVMVYAAYKPKIVGT
YRHPLLLTVFGVLVVLVMAYLGGYTLVQQLPKLFAL