Protein Info for CA264_08710 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00480: ROK
  • amino acids 138 to 404 (267 residues), 207 bits, E=2.2e-65

Best Hits

KEGG orthology group: None (inferred from 37% identity to psn:Pedsa_0015)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• glycogen degradation I (7/8 steps found)
• Bifidobacterium shunt (12/15 steps found)
• glycogen degradation II (5/6 steps found)
• trehalose degradation II (cytosolic) (2/2 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation IV (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• trehalose degradation I (low osmolarity) (1/2 steps found)
• 1,3-propanediol biosynthesis (engineered) (6/9 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sucrose biosynthesis II (5/8 steps found)
• sucrose degradation III (sucrose invertase) (2/4 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (3/6 steps found)
• chitin biosynthesis (5/9 steps found)
• heterolactic fermentation (11/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

See A0A1X9YRP0 at UniProt or InterPro

Protein Sequence (416 amino acids)

>CA264_08710 sugar kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSTLTSHTDYLESLNNVEKKKFLQKVKIIRHLYVKGVRTNADICSRFNISSPTSMGLLGE
LISEGLVEKQGLGKSVGGRKPDLYGLRNNSLFVLSIEMDRFSTRMVIVDNNNNQITPVRT
YAYTLPEDLSGLNELCTRVEEHIATSGIDPKKLVGIGISMPGLVAGKEGNNHTYLRTDLL
EESLQELLSQKLGKPVFIQNDVKSAALAELRFGEAKGKQDVLVLSMDWGIGTGVIMDGKL
RGGTSGFAGEFGHIPLIEDGSLCHCGKRGCLETVASGVSLTSIARQRIKEGQKSLLSKLP
DEELDELEPQTLIDAAHNGDQFAINMLSETGKHLGKGIAILIQLFNPELIILGGKIAEAK
QFITTPIQQAINTYCMAQLRESTSIALSTLGQSASMLGAAATVLENILEQQLEQAR