Protein Info for CA264_08670 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details amino acids 387 to 414 (28 residues), see Phobius details PF05684: DUF819" amino acids 17 to 412 (396 residues), 296.7 bits, see alignment E=1.3e-92

Best Hits

KEGG orthology group: None (inferred from 66% identity to shg:Sph21_3251)

Predicted SEED Role

"DUF819 domain-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRK6 at UniProt or InterPro

Protein Sequence (419 amino acids)

>CA264_08670 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MTESSAPLITNEAVVLGILLVILAIVFQTSASSNRFWLKFYKVVPSVLLCYFLPALLNTF
NIISGETSQLYFVASRFFLPASLILLTLSIDFKSLRMLGSKAVIMFFAGTVGVMLGGPLA
LFLVGSAFPDVLYTGTDEVWKGLSTISGSWIGGGANQAAMLEVFGASKEAFGQMIAVDVL
VANVWMGFLLYWSQKPEKIDKLLNADSRPIRELEERLEGLQAGKRVIPTATTTMIVLGVA
FGFTGLSHFLADIIAPYFAENFPALETYSITSGFFWLVILATTAGLVLSFTKASELESYG
ASRFGTVFLYFLVATIGMSMDLAAVLDNPKLFLVGALWIIFHIIIMLVVARIIRAPFFYV
AVGSQANIGGAASAPIVAVAFNKFLAPVGVLLAVLGYAVGTYGAYLCGLMLQYVWNMLA