Protein Info for CA264_08660 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 108 to 143 (36 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 235 to 268 (34 residues), see Phobius details amino acids 284 to 313 (30 residues), see Phobius details amino acids 372 to 395 (24 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 14 to 213 (200 residues), 57.6 bits, see alignment E=6.3e-20 amino acids 239 to 401 (163 residues), 34.4 bits, see alignment E=7.3e-13

Best Hits

KEGG orthology group: None (inferred from 53% identity to hfe:Hfelis_10630)

Predicted SEED Role

"Methionine transporter MetT" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRL6 at UniProt or InterPro

Protein Sequence (446 amino acids)

>CA264_08660 sodium:proton antiporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MQHIQKTGGWALVPFLVFVLTFLGAGILLNDFYALPAPVAVLLGIVSAFFILRGSTEAKV
AALIRGCGDSKIVTMCLIYLLAGAFATVTKAVGGVDATVNLGLSVLPVQYLALGVFLLAA
FLSTATGTSVGAIVALGPIAVGLAEQSHTSLPLLLGALLGGAMFGDNLSFISDTTIAATQ
TQECSMRDKFRVNILIAGPAALVTIGLLLFTGWNTAGTPENLLPELHAASFWQIAPYQLV
IVLAVSGVNVFVVLTVGTLASGAVGLATGHLEVLSFGRSVYEGFTGMIEIFLLSMLTGGL
AQMVNEAGGIAFLLQRVSKATRGFRSAQTGILALVGGTNTAIANNTVSIVVTGQVVKEVS
RKYSIDKRKTAALLDIASCVVQGLLPYGAQILILLSFTEGQLSFLDLWASAWYLYLLLLF
SLVAIYTPLVDRFLARQPAAAPAVAA