Protein Info for CA264_08655 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DUF58 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details PF01882: DUF58" amino acids 199 to 283 (85 residues), 78 bits, see alignment E=2.7e-26

Best Hits

KEGG orthology group: None (inferred from 60% identity to sli:Slin_4966)

Predicted SEED Role

"Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRL2 at UniProt or InterPro

Protein Sequence (443 amino acids)

>CA264_08655 DUF58 domain-containing protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MAFIRSLYFTNRLYLNLAALVCLFVVAFFVPVLLVVAKVGTAVLLLLTLVDLLMLYSNKA
GMHASRSMQEKLSNGSDNEIHLYLENRYSFAVRTEVIDELPFQFQKRDTLFQAQIPKGRT
HIILYTLRPTKRGSYSFGAINVFAMGPLRLVKRRYRFAQDQEVPVYPSFVQMRQYELMAV
SNRLHEVGVKKVRRMGHSSEFEQVRPYVAGDDQRTINWKATARKADLMVNSYQDEKSQQV
YCLIDKGRVMQMPFEELTLLDYAINASLVISNIALKKQDKAGVITFSDKISNILPAQRKE
NQLRRILELLYNQKTLYQETDYERLYTTVRHSLKQRSLLLLFTNFETLNGAERQLPYLRA
LARHHLLVVIFFENTELHEVLRRPATNTAQVYTKAIAQKFSYDKRKVVKVLRQHGIHTIL
TPPQDLTVNTINKYLELKARGLI