Protein Info for CA264_08650 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: magnesium chelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF20030: bpMoxR" amino acids 25 to 227 (203 residues), 48.6 bits, see alignment E=1.9e-16 PF00158: Sigma54_activat" amino acids 40 to 166 (127 residues), 22.2 bits, see alignment E=3.4e-08 PF00493: MCM" amino acids 45 to 171 (127 residues), 27.1 bits, see alignment E=7.4e-10 PF07728: AAA_5" amino acids 53 to 181 (129 residues), 53.9 bits, see alignment E=6.9e-18 PF07726: AAA_3" amino acids 53 to 183 (131 residues), 205 bits, see alignment E=1.2e-64 PF00004: AAA" amino acids 54 to 187 (134 residues), 26.5 bits, see alignment E=2.7e-09 PF17863: AAA_lid_2" amino acids 250 to 322 (73 residues), 82.7 bits, see alignment E=4.3e-27

Best Hits

Swiss-Prot: 47% identical to YEAC_BACSU: Uncharacterized protein YeaC (yeaC) from Bacillus subtilis (strain 168)

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 67% identity to sli:Slin_4963)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRM7 at UniProt or InterPro

Protein Sequence (330 amino acids)

>CA264_08650 magnesium chelatase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQEDLLTATQENKTDYTALRTATERIKQELRQIIVGQEKLIELLLVAMLAEGHVLIEGVP
GIAKTLTAKLLARTVQVDFSRIQFTPDLMPSDVLGTSVFHPGSATFEYKQGPIFANIVLI
DEINRAPAKTQASLFEVMEEQHITHDGRVYPLAAPFVVLATQNPIEQEGTYRLPEAQLDR
FMFKVLVDYPSLEEEVAILELQHKGAALRKDLERVQPVLSAAQLLELRKAVQAVHLDRKL
IEYIAQIIGETRVNRSLYLGASPRASIALLNSAKAMAALRGRGFVTPEEVQELAPVVLRH
RILLTPEREMEGITPDEVIKQIVQKIEVPR