Protein Info for CA264_08610 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NCS2 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 160 to 185 (26 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 229 to 238 (10 residues), see Phobius details amino acids 241 to 265 (25 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 347 to 365 (19 residues), see Phobius details amino acids 377 to 401 (25 residues), see Phobius details amino acids 416 to 432 (17 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 17 to 395 (379 residues), 146.4 bits, see alignment E=5.1e-47

Best Hits

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 71% identity to dfe:Dfer_5288)

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRK8 at UniProt or InterPro

Protein Sequence (434 amino acids)

>CA264_08610 NCS2 family permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MESYFHLNRHNTNVKTEVLAGVSSFLATAYVIVVNPTILSQAGMPFSGVLTATVLVSFFS
SVMMGFYARNPILVAPGMGLNAFFTYSAVLGMGISWQVALGAVFWSGVVFLLLSLFNVRT
LIVRAIPKPLRYAIAAGIGLFITLIGFANAKFIVANPSTIIGISPMTPALLTFLAGLLLT
AVFIVRNVKGGILLGILFTTLASYPIGRWWGTDLAPLITWQGLVAAPDFSLLFQLDLINS
FKLSVVPVIFAFVFTDMFDSVSTFVGLAEAANLMDENGEPQNVQRSLTTDAVATTLAGLV
GSSPGTAYVESAVGIEMGGRTGLTAVVGGALFLPFLFLAPLLSMIPPIATAPALVLVGAF
MVRPVTKIDWFKMDDAIPAFLAMVLIPFTYSITQGIIWGFLCWTALKLVTGKRNEISWML
WVINIFAILAILQH