Protein Info for CA264_08580 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: K+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 302 to 326 (25 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 17 to 387 (371 residues), 171.9 bits, see alignment E=1.9e-54 PF02080: TrkA_C" amino acids 416 to 485 (70 residues), 45.7 bits, see alignment E=4.9e-16

Best Hits

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 56% identity to zpr:ZPR_3757)

Predicted SEED Role

"Na(+)/H(+) antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY02 at UniProt or InterPro

Protein Sequence (485 amino acids)

>CA264_08580 K+/H+ antiporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MNFTIEDILLGTSILLFLSILVSKSLGRLGIPALVLFLGVGMLAGSDGIGGIYFDDSQTA
QSLGTVALTLILFSGGLDTNWASTRSVLWRGVTLSTAGVLVTALLVGAFASYVLHFTLLE
GVLLGAIVSSTDAAAVFSILRSRNIGLKNNLRPTLELESGSNDPMAYFLTVSFTFLLTNQ
EASLWELVPLFFLQMSIGAVMGVVMGNVMAWTINRIKLGQEGLYPALTLAMLLFTFAFTN
LINGNGFLAVYTSAVILGNRNFIHKRSLTRFYDGVAWLSQILMFLTLGLLVFPSQVVPVA
GAGLLISLFLIFVARPASVFLSLAFFNASWRDKLYVSWVGLRGAVPIVFATYPLLAGVEK
SGLIFNIVFFIVLTSVMLQGTTLQLVADWLGLSEVDDSLKRVQLGEELGYDAKNELVELQ
LSAGSAAVGKSLVELQLPKSSLIVLIDRGGKFVTPVGATVLQAYDKLMVMVDSEQELKRV
RELLG