Protein Info for CA264_08475 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13637: Ank_4" amino acids 24 to 73 (50 residues), 40.4 bits, see alignment E=6.8e-14 amino acids 67 to 106 (40 residues), 24.5 bits, see alignment 7e-09 amino acids 95 to 139 (45 residues), 37.7 bits, see alignment E=4.8e-13 amino acids 121 to 159 (39 residues), 26.2 bits, see alignment 2e-09 PF12796: Ank_2" amino acids 25 to 116 (92 residues), 70.5 bits, see alignment E=3.6e-23 amino acids 90 to 171 (82 residues), 57.4 bits, see alignment E=4.7e-19 PF00023: Ank" amino acids 25 to 50 (26 residues), 15.5 bits, see alignment 4.6e-06 amino acids 53 to 83 (31 residues), 32.5 bits, see alignment 1.8e-11 amino acids 86 to 116 (31 residues), 26.3 bits, see alignment 1.7e-09 amino acids 118 to 149 (32 residues), 30.9 bits, see alignment 5.8e-11 PF13857: Ank_5" amino acids 39 to 90 (52 residues), 44.9 bits, see alignment E=2.9e-15 amino acids 105 to 159 (55 residues), 41 bits, see alignment E=4.6e-14 PF13606: Ank_3" amino acids 53 to 81 (29 residues), 19.9 bits, see alignment 1.9e-07 amino acids 118 to 146 (29 residues), 24.3 bits, see alignment 6.7e-09

Best Hits

Swiss-Prot: 43% identical to Y3287_PSEAE: Putative ankyrin repeat protein PA3287 (PA3287) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06867, (no description) (inferred from 61% identity to sli:Slin_0458)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRK1 at UniProt or InterPro

Protein Sequence (172 amino acids)

>CA264_08475 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKSLFLNFLFLMLPALVFAQAPDLTAAARTGDVATIKQLLQNKAEVNAQDQKGFTPLIIA
VYNGQAEAAKLLLEAGADLNHQDATGNTALMGTAFKGNPAMAELLLSKGANPNLQNANGG
TALMMAAMFGRNEVIKLLLSNGADKNLRDQRGLTALDLAKQQQNQEGIALLQ