Protein Info for CA264_08470 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR01035: glutamyl-tRNA reductase" amino acids 42 to 446 (405 residues), 247.4 bits, see alignment E=1.4e-77 PF05201: GlutR_N" amino acids 43 to 193 (151 residues), 109.5 bits, see alignment E=4.1e-35 PF02826: 2-Hacid_dh_C" amino acids 212 to 289 (78 residues), 26.6 bits, see alignment E=1.1e-09 PF01488: Shikimate_DH" amino acids 218 to 338 (121 residues), 77 bits, see alignment E=4.8e-25 PF03446: NAD_binding_2" amino acids 226 to 297 (72 residues), 27.9 bits, see alignment E=6.5e-10 PF03807: F420_oxidored" amino acids 226 to 291 (66 residues), 25.1 bits, see alignment E=6.5e-09 PF00745: GlutR_dimer" amino acids 356 to 447 (92 residues), 37.7 bits, see alignment E=6.8e-13

Best Hits

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.70

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRF5 at UniProt or InterPro

Protein Sequence (448 amino acids)

>CA264_08470 glutamyl-tRNA reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MGTLPHRELGDGFSKALTVPASFKTPGSTSSNTYSTMNTLQAISLSHETASLEWRQALQL
SKEEATAFMVHLKERELADAVMVVTTCNRTEVYFESAGTTAEVIQQELLQFKGVADEAAF
SPLFKHFTHSEDTLQYLLEVGLGLRSQVLGDRQIIGQFKDSYQLTKDLNLGGTLLHQALQ
TLFRTHKRVHNETSFRSGASSVGYAALERISDFIPRKEFSGKRMLIIGTGQMGTDIARYA
TSFGFQDVTLTNRTDEKAQTLAGKLNLKTIPFADRFSAMASYDVIISCVSAGEQLTPSQI
GMPLQENKRVLVDLSVPLSISPAAAQLPRTTLVNMDQITSRTEAVKKAREASISDVRHIV
EKETAGFAHWLQDLPLYHSIGELKAFFATVLESELQKHTSLQEGDAASKLAKATLDRLIR
RPAGALRAADGASREVLLQSLNQLFQIA