Protein Info for CA264_08315 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: PAS sensor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 PF08446: PAS_2" amino acids 24 to 127 (104 residues), 57.1 bits, see alignment E=4.3e-19 PF01590: GAF" amino acids 159 to 317 (159 residues), 55.3 bits, see alignment E=1.6e-18 PF00360: PHY" amino acids 336 to 513 (178 residues), 177.8 bits, see alignment E=2e-56

Best Hits

KEGG orthology group: None (inferred from 40% identity to chu:CHU_1235)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRH1 at UniProt or InterPro

Protein Sequence (517 amino acids)

>CA264_08315 PAS sensor protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MNNKAAPINLSIDHNYDSEFCGSIPLHLVNLIQPHGVLLVLDKEELRIKQVSENVEQHLA
IAVDELLEQPFSSYLPDLQYQDLLYKINSGNSQEKIPFSLTLQLQGREQDFIALVHPEQE
HVLVELEENAASSDKSFIGIYQHIKYITTLLKQASTTSATAQLAADELKKFTGFDRVLVY
QFDPQWNGIVVAQAKEDDMDDYMDLRFPASDVPKQARDLYFKNPYRLIPTRDYKPQRLIP
IVNPITQRFTDLSDCNLRSVASVHLEYLANMQIVASMSLPLIVDNKLWGLISCHHKTAKN
PSYEQRSGMELLAGIVSAQLAGKERESAILLRAQLRSIHAHLLEQLYNSQNFVEGLLSGS
VTIQDLLSLTGAAVLYEGNVWTSGDTPGEQELRELVSWLRRNRSEKIIATATLPQEYAHS
RIYKDVASGLVALPINPEQGEYILGFRPEVLQTVNWGGDPKKAIQMEDDGKTYHPRNSFA
TYKETVKYTSLPWQEEEIEAAAVLRSAVLEKIIKDKY