Protein Info for CA264_08265 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: iron-sulfur cluster assembly accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 2 to 108 (107 residues), 112.4 bits, see alignment E=5.6e-37 PF01521: Fe-S_biosyn" amino acids 2 to 103 (102 residues), 81.1 bits, see alignment E=3.5e-27

Best Hits

Swiss-Prot: 47% identical to ERPA_AROAE: Putative iron-sulfur cluster insertion protein ErpA (erpA) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K13628, iron-sulfur cluster assembly protein (inferred from 66% identity to cpi:Cpin_3356)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRG3 at UniProt or InterPro

Protein Sequence (108 amino acids)

>CA264_08265 iron-sulfur cluster assembly accessory protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MITVSEKAKAYISNQLEKEQRSADTLIRVGVKSGGCSGLEYQLAFDTERREEDEVFESNG
LTIVTDKMSLFYLLGTELDYSGGLNGKGLYFNNPNASRTCSCGESFAV