Protein Info for CA264_08190 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 87 to 112 (26 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details PF12833: HTH_18" amino acids 313 to 394 (82 residues), 72.4 bits, see alignment E=3.2e-24 PF00165: HTH_AraC" amino acids 353 to 392 (40 residues), 31.5 bits, see alignment 1.5e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRC0 at UniProt or InterPro

Protein Sequence (405 amino acids)

>CA264_08190 AraC family transcriptional regulator (Pontibacter actiniarum KMM 6156, DSM 19842)
MSYRRKHNASVKGIVLVPRKKQTISSMDNPLLIGVTCGGAFLLAFLLFNHPSRSNTAANR
WLGFFVATFACAMLEVFLHNLSLHVLYPAAFAFIEAVRFLSAPTLYLSILVFTTPTKKFR
ARELWHFAPFALWLLFQLANVWRGENLRFESELLQNAFLSVVRLSVPFQTVAYLVLCFRR
LRQHRLNIEKVASATEAVDLSWLRHFLLALVVVVLVWFNLAFFNFKQLFSLTPFLYLTGL
YSLAFFSLRQKEIFAFAPAQLAELKPVIEPVSERDEKQKRLSESMMQSLQLRLEQEMQYE
KAFLENELSLPVLAQKVGVSAHELSYLINQVYGENFYAFVNRHRVEEAKRLLSSPEADKL
NMLGIAYQAGFNSKTTFNTAFKKHTGLSPTEYGKQARPRQQAKNA