Protein Info for CA264_08105 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NupC/NupG family nucleoside CNT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 370 to 393 (24 residues), see Phobius details amino acids 409 to 432 (24 residues), see Phobius details PF01773: Nucleos_tra2_N" amino acids 10 to 82 (73 residues), 84.7 bits, see alignment E=7.9e-28 PF07670: Gate" amino acids 97 to 195 (99 residues), 61.3 bits, see alignment E=1.6e-20 PF07662: Nucleos_tra2_C" amino acids 208 to 428 (221 residues), 250.8 bits, see alignment E=1.7e-78

Best Hits

KEGG orthology group: K03317, concentrative nucleoside transporter, CNT family (inferred from 52% identity to hhy:Halhy_5138)

Predicted SEED Role

"Nucleoside permease NupC" in subsystem Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRA2 at UniProt or InterPro

Protein Sequence (433 amino acids)

>CA264_08105 NupC/NupG family nucleoside CNT transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MYDILRGLGGLIVLIGIAILFSRNRKAIDWKLVGFGIFLQILFGVLVTQVPFVTDAFAFV
SKLFVKLLSFSQAGAEFLFGSLANPANNGGLGFIFAFSVLPTIIFFSTVSAGLYYLGVLQ
KIVFGIAWVMSKGMRLSGAESLSAAGNIFLGQTEAPLLVRPFISRMTKSELMCLMTGGMA
TLAGGVLAAYVAFLGGSDINQQAVFAAHLLTASIMNAPAGIVLAKILVPETEPEKIHTEL
EVNEEQLGVNLIDALSRGAADGLKLAANVGGMLLAFIAVIALLNYILIKIGGLTGMNEFV
VASTNGQFDGFSFQYILGQIFRIFAFIMGVPWQDTLQVGSLLGQKTAVNEFVAYLDLANM
KAAGTLGDKALIMATYALCGFSNFSSIAIQVGGIGSMAPNQQGTLSKLGFLALLGASLAC
MMTATVAGMLYAL