Protein Info for CA264_08095 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 133 to 158 (26 residues), see Phobius details amino acids 179 to 203 (25 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details PF02405: MlaE" amino acids 29 to 239 (211 residues), 208.8 bits, see alignment E=3.7e-66

Best Hits

Swiss-Prot: 36% identical to Y1340_RICBR: Probable ABC transporter permease protein RBE_1340 (RBE_1340) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 66% identity to dfe:Dfer_3962)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXW8 at UniProt or InterPro

Protein Sequence (242 amino acids)

>CA264_08095 ABC transporter permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MQHFGKYLIFMKSLFTRTESSKIIFNRTIDEAVLIGINSIFIVSIVSTFIGAVTSVQTSY
NLVNALIPRSTIGFMVREMTILELAPTITSIVLAGKVGSSIAGGLGTMQITEQVDALEVM
GINSASYLVLPKVLAALLVFPMLVIISMFLSIAGGYFAGILTGEVTAQEYITGIRGDFIP
YNIVFALIKAEVFAFLIASISSFRGYFTSGGALEVGAASTTAVTNSVIAVLIADFICAQL
LL