Protein Info for CA264_08075 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: gliding motility-associated ABC transporter permease subunit GldF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details TIGR03518: gliding motility-associated ABC transporter permease protein GldF" amino acids 1 to 239 (239 residues), 347.7 bits, see alignment E=2.3e-108 PF12679: ABC2_membrane_2" amino acids 2 to 185 (184 residues), 42.1 bits, see alignment E=1.4e-14 PF12730: ABC2_membrane_4" amino acids 18 to 175 (158 residues), 38 bits, see alignment E=3.6e-13 PF13346: ABC2_membrane_5" amino acids 50 to 230 (181 residues), 27.8 bits, see alignment E=3.5e-10 PF12698: ABC2_membrane_3" amino acids 51 to 185 (135 residues), 34.3 bits, see alignment E=2.9e-12

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 60% identity to chu:CHU_1546)

Predicted SEED Role

"gliding motility protein GldF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR95 at UniProt or InterPro

Protein Sequence (242 amino acids)

>CA264_08075 gliding motility-associated ABC transporter permease subunit GldF (Pontibacter actiniarum KMM 6156, DSM 19842)
MLAILKKEFNGFLNSLIAYIVITVFLVAIGMFMWVFPESSVLEYGFADMQTLFNMAPWVF
LFLIPAITMRTFAEEKREGTIELLLTKPITDLQLILGKYFAALLLALFALLPTLLYYYSV
YQLGSPQGNVDSAAVVGSYLGLVFLAGVFCAIGVFASAVSDNQIISFVIAVFLCFIIYTG
FDSIASVPVFGGVDYLISQLGISYHYEAISKGLVDSRDVLYFLSVIAIMILATKLVLRSR
KW