Protein Info for CA264_08070 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: gliding motility-associated ABC transporter substrate-binding protein GldG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 33 to 33 (1 residues), see Phobius details amino acids 532 to 555 (24 residues), see Phobius details TIGR03521: gliding-associated putative ABC transporter substrate-binding component GldG" amino acids 15 to 560 (546 residues), 670.9 bits, see alignment E=7.5e-206 PF09822: ABC_transp_aux" amino acids 37 to 317 (281 residues), 284.1 bits, see alignment E=5.7e-89

Best Hits

KEGG orthology group: None (inferred from 45% identity to dfe:Dfer_3719)

Predicted SEED Role

"gliding motility protein GldG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRA7 at UniProt or InterPro

Protein Sequence (563 amino acids)

>CA264_08070 gliding motility-associated ABC transporter substrate-binding protein GldG (Pontibacter actiniarum KMM 6156, DSM 19842)
MVMEQHKSNRSSDILKFLAWVAGIVLLNVVAANYFFRLDLTEDKRYTIAPVTKQMLGGLE
NEIVVDVYLEGDFPAGFKRLQQSVRETLDEFRIYADGNLRYNFIDPTDIADEKQRNEFYT
SLAQKGIIPTNLRATEEGKQVERLVFPGAVIRYKGKEAAVNLLKGNLAATPDERLNQSVE
GVEYELATAIRKVAFQGNKIIGYITGQGELEQQQVTDLLGSLQEYYRVARGDLAQIPSLD
GLDLIIVAKPTQAFTEADKYKIDQFIMKGGKAVFFVDPMYADLDSVAAGGTFALPYNLNL
DDLLFRYGVRLNPNLIMDLNSGFIPIVTGYMGDRPQTEMINWRFYPLLNNFSDHPITRNL
DAVYSKFVSTMDTVKADGIRKTPLVYTSAYSRVLDAPVPLTLEEARLEVNPQQYQAGQQP
VGYLLEGPFTSLFRNRKAPAGVQQAAVQEKGVPTKIAVFADGDLVRNDINARTGQAYELG
FDRFNNITFANKELAMNTIHYLLDSEGLINVRSKEIELRPLDKVRLKEEKTYWQLLNLVA
PIVLLGLFGVARYYLRKRRYERF