Protein Info for CA264_08060 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details PF00512: HisKA" amino acids 220 to 284 (65 residues), 42.7 bits, see alignment E=4.9e-15 PF02518: HATPase_c" amino acids 331 to 439 (109 residues), 98.6 bits, see alignment E=3.1e-32

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR98 at UniProt or InterPro

Protein Sequence (441 amino acids)

>CA264_08060 two-component sensor histidine kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKLYFYRSAPEAYTKAFSRYYLPQNLKALRLLSRVWLLIALLVLASDFVFQYAAHYSGAA
FYRVAYYSYAVSGAAVWFLDRWLGGEETEQNHRLYRLLCLGYAFVFAVTCLLMSVAVQGS
PVNNMTMYLLGLSLVATLFVLELREVLVLATLVELTFVVGVAFLDLPLERVIMNQTGSLF
LILFFFLISRLNYSFRVNHFMQLRLIEAKNEELNALNKAKTDILGIVAHDLRGPFGNIEM
MAKMLQKNTLPAEQQARFYDMILKSCQSSKGIINDLLDMARFEQEEPFELVPVDLRAFVD
TVQQEWQLQLKESRSLSVQCSAAPLLVNLNQERFRRVLDNLISNAVKFTQEQGHIQVQLS
QQQRQVLLCISDDGVGVPPEMRPHLFSPFSKAGRKGVRGEHSVGLGLSIARKLVELHQGT
IEIDNEQQQGASFRILLPACS