Protein Info for CA264_08025 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: GMP synthase (glutamine-hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain" amino acids 5 to 190 (186 residues), 210.3 bits, see alignment E=1.7e-66 PF00117: GATase" amino acids 6 to 186 (181 residues), 133.4 bits, see alignment E=2e-42 PF07722: Peptidase_C26" amino acids 72 to 169 (98 residues), 30.9 bits, see alignment E=5.9e-11 TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain" amino acids 198 to 509 (312 residues), 469.8 bits, see alignment E=4.1e-145 PF02540: NAD_synthase" amino acids 209 to 281 (73 residues), 34.6 bits, see alignment E=3e-12 PF03054: tRNA_Me_trans" amino acids 215 to 248 (34 residues), 22.7 bits, see alignment (E = 1.8e-08) PF00958: GMP_synt_C" amino acids 418 to 508 (91 residues), 148 bits, see alignment E=1.7e-47

Best Hits

Swiss-Prot: 77% identical to GUAA_CYTH3: GMP synthase [glutamine-hydrolyzing] (guaA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 78% identity to mtt:Ftrac_3641)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXV6 at UniProt or InterPro

Protein Sequence (509 amino acids)

>CA264_08025 GMP synthase (glutamine-hydrolyzing) (Pontibacter actiniarum KMM 6156, DSM 19842)
MPEKILILDFGSQYTQLIARRVRELNVYCEIFPYNNVPELTDEVKGVILSGSPCSVRDAE
HPNIDLDQYLGKLPVLAVCYGAQLIAHEKGGEVTPSTIREYGRARLSVLHNHDRLLKELT
LGSVVWMSHGDTIREIPDNFEVIASTDSVRVAAYKLRDQDTYGIQFHPEVTHSDEGKTLL
RNFVVHICGCLQDWTSEQFIDATVAELKEQIGNDKVVLGLSGGVDSSVAAMLIHQAIGKN
LYCIFVDNGLLRKNEFETVLDSYKHMGLNVKGVDAKEKFYTALAGLTDPEQKRKAIGRVF
IEVFDDEAHQIEDVKWLAQGTIYPDVIESMSVKGPSATIKSHHNVGGLPDFMKLKVVEPL
KTLFKDEVRLVGRTMEIDETILGRHPFPGPGLAIRILGDITPEKVQVLQQVDHIFISNLK
KSGLYDEVWQAGAILTPVQSVGVMGDERTYENVVALRAVTSIDGMTADWSRLPYEFLADV
SNEIINKVKGVNRVVYDISSKPPATIEWE