Protein Info for CA264_08015 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: fructose-6-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 80% identical to TAL_CYTH3: Probable transaldolase (tal) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 80% identity to chu:CHU_2529)

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

superpathway of glucose and xylose degradation (16/17 steps found)
pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
pentose phosphate pathway (7/8 steps found)
Bifidobacterium shunt (12/15 steps found)
Rubisco shunt (8/10 steps found)
formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR85 at UniProt or InterPro

Protein Sequence (218 amino acids)

>CA264_08015 fructose-6-phosphate aldolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKFFIDTANLQEIQEAHDLGVLDGVTTNPSLMAKEGIFGHDNVIAHYKKISEIVDGDISA
EVIATDFEGIVREGEFLAELHPNIVVKVPMIRDGVKAIRYFSEKGIKTNCTLVFSAGQAI
LAAKAGATYVSPFVGRLDDISTDGMQLIEQIVQIYGNYGYQTQVLAASVRHVMHLVQCAE
VGADVVTCPLNVITGLLKHPLTDSGLEKFLADHAKGNK