Protein Info for CA264_07960 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: pseudaminic acid cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR03584: pseudaminic acid cytidylyltransferase" amino acids 4 to 224 (221 residues), 304.6 bits, see alignment E=2.1e-95 PF02348: CTP_transf_3" amino acids 4 to 133 (130 residues), 94.4 bits, see alignment E=4.7e-31

Best Hits

Swiss-Prot: 42% identical to PSEF_CAMJE: Pseudaminic acid cytidylyltransferase (pseF) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K00983, N-acylneuraminate cytidylyltransferase [EC: 2.7.7.43] (inferred from 62% identity to osp:Odosp_0121)

Predicted SEED Role

"N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.7.7.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.43

Use Curated BLAST to search for 2.7.7.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR87 at UniProt or InterPro

Protein Sequence (230 amino acids)

>CA264_07960 pseudaminic acid cytidylyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSSIAIIPARGGSKRIPRKNIKSFLGEPIITYSIKAALMSGLFDEVMVSTDDEEIAQVAR
DSGATVPFLRSAAASDDFASTAQVLEEVLTSYKNQGRTFDQGCCIYPTAPFVTAQLLDLA
HARLSEGDFDTVFPVLRYSYPIWRSLKVEEGKALMNWPEHLQSRSQDLPHAFHDAGQFYW
FRVESFLKKRVLFTDNSGVVELSELEAQDIDSETDWKLAELKYKLLYNLD