Protein Info for CA264_07955 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR03588: UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase" amino acids 13 to 396 (384 residues), 469.9 bits, see alignment E=2.8e-145 PF01041: DegT_DnrJ_EryC1" amino acids 19 to 394 (376 residues), 374.3 bits, see alignment E=7.4e-116 PF00155: Aminotran_1_2" amino acids 41 to 174 (134 residues), 37.3 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: None (inferred from 66% identity to bhl:Bache_1939)

Predicted SEED Role

"Bacillosamine/Legionaminic acid biosynthesis aminotransferase PglE; 4-keto-6-deoxy-N-Acetyl-D-hexosaminyl-(Lipid carrier) aminotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR82 at UniProt or InterPro

Protein Sequence (400 amino acids)

>CA264_07955 UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTQNSELKTNKPIPYGRQNITEDDIAAVVETLQSDYLTQGPKVAEFENAFAKYVGAKYAV
AVSNGTAALHLCTMALGVNEESRVITTPITFVASANCVRYCGGTVEFADIDLNTALLSVE
KVRELIESKPKGYYSGIIPVDFAGNPVNLEEFRKLADAHGLWIIEDAAHSPGGYFIDSKG
QKQLCGNGQFADLAIFSFHPVKHIATGEGGMVTTNDEALYKKLLLYRTHGITRDPELLEE
NHGGWYMEMQELGYNYRIPDMLCALGISQLQRADAGMARRRGIAKVYDKAFAEVAGIETL
QTTPAALHDDETGHAYHLYVIKVQDRKGLYDFLRGHNIFAQVHYIPAHTMPYYRNLGYQK
GDFPAAEQYYSECLSLPMYPTLTHEEQEFVIEKVKEFVQK