Protein Info for CA264_07935 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF13579: Glyco_trans_4_4" amino acids 31 to 240 (210 residues), 46 bits, see alignment E=1.5e-15 PF13439: Glyco_transf_4" amino acids 114 to 243 (130 residues), 44.8 bits, see alignment E=2.9e-15 PF00534: Glycos_transf_1" amino acids 247 to 404 (158 residues), 40.3 bits, see alignment E=5.1e-14 PF13692: Glyco_trans_1_4" amino acids 258 to 367 (110 residues), 31.2 bits, see alignment E=4.9e-11

Best Hits

Predicted SEED Role

"TPR/glycosyl transferase domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRA3 at UniProt or InterPro

Protein Sequence (440 amino acids)

>CA264_07935 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKETDLTDLLYISYYWPPSGGPGVQRGLKFCKYLPQFGVQPTVLTVDEKQASYPLLDETF
VQEVPEGLPVHRTATSEPFEYYKKLSGKKEIPYSGFANQQTKDNLVDKLFKFVRGNLFIP
DARVGWNKHALRKADELLQSGKYKAIVTTSPPHSTQLIGLKLKKKYNLPWIADLRDPWTN
IHYYDQLYHTALAKRLDEKYERQVLEQADAIIVTSEDTKRLFLNKPASIAVDKIHVIPNG
YDAADFTFQSKPPKDEFLITYTGTITENYNIDVFLKVLAHLLSLHSEINYKLRFVGKVSE
GMKKRIEKAGVLGITEFVPYVPHQESIKYMMESTVLFLAIADVENVYANVPGKLFEYLAS
NKPIVALGPVHSDMDRIIDECGAGRLFHYTAYDLMLDHMNQWSKAWKINPNLDLPYINHS
RFSREALTQELAAIVKQLVR