Protein Info for CA264_07925 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 786 PF00072: Response_reg" amino acids 22 to 124 (103 residues), 79.9 bits, see alignment E=4.1e-26 amino acids 541 to 653 (113 residues), 96.3 bits, see alignment E=3.4e-31 TIGR00229: PAS domain S-box protein" amino acids 159 to 272 (114 residues), 37.3 bits, see alignment E=1.4e-13 PF00989: PAS" amino acids 160 to 262 (103 residues), 33.5 bits, see alignment E=9e-12 PF08448: PAS_4" amino acids 166 to 265 (100 residues), 45.6 bits, see alignment E=1.9e-15 PF00512: HisKA" amino acids 286 to 349 (64 residues), 80.6 bits, see alignment E=1.7e-26 PF02518: HATPase_c" amino acids 397 to 511 (115 residues), 101.8 bits, see alignment E=7.8e-33

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR83 at UniProt or InterPro

Protein Sequence (786 amino acids)

>CA264_07925 hybrid sensor histidine kinase/response regulator (Pontibacter actiniarum KMM 6156, DSM 19842)
MTLSAVQTFTQLQDALPEQLSILIIDDDKVDQMALMRSLQKSGLSTQTYTANTAQAGLRL
LLAQTFDCIFIDFMLPDMDGLELMEHISKLELSAPVLVVTSHGDERIAAQAMRLGAADYL
PKSMLTPQNVSHSIRSAIRLRKAELKRMESEQRLRDTQYQLDLIISNSPMAFYSTNAAGE
VLFAQGRAYDLIGVKQEELIGRPYYELFQHYPRIVNRFKRALNGETIQSVDETNGYFLKA
HYIPVYDAAGRMMGVTGFALDITERIQNERELTQAKEVAEKSVRVKEQFLANMSHEIRTP
MNGIIGLTNVLQKTQLNDEQHKFLKAIQTSANNLMQIINDLLDFSKITSQQFTFEHIAFC
LPELVQDIVLLMETRASERGNRLSTYLDASVPQQLIGDPLRLKQVLLNLVGNAIKFTDQG
EIKLLIHSIGQKDEKLMLEFTVEDTGIGIAEDKLQVIFESFNQGSNDTTRKYGGTGLGLS
ISKHLVEMQGGTMAVRSHPKVGSAFTFSLPFGVQQPLPEQAPESEEQPLSEPAGALGELR
ILLAEDNEINQLLIYTVLSDWGVTLDTVFNGLEALQLFEQQEYDLILMDMQMPEMDGYEA
TRRIREMDGPKARTPIIALTAHATTGEIEKCLAAGADAYVSKPFEPEYLYDTIYRLTQCS
TAIVLPSDAAPGINLEPLLRLVSDRNGFLAELLTLCLHNTLLAVEQLKHSLKSGELQLLP
NIVADLFDSVSVVAAQPLLGRLKSLKEAISCQDAALVETLVLQVISDCQETVALLENERM
QLSAQV