Protein Info for CA264_07855 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ribonuclease BN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 12 to 276 (265 residues), 82.1 bits, see alignment E=2.9e-27 PF03631: Virul_fac_BrkB" amino acids 25 to 278 (254 residues), 172.4 bits, see alignment E=7.3e-55

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 46% identity to mtt:Ftrac_2469)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR59 at UniProt or InterPro

Protein Sequence (302 amino acids)

>CA264_07855 ribonuclease BN (Pontibacter actiniarum KMM 6156, DSM 19842)
MNPKVKLTWNLTKRTFKEFVDDAPLDYAAIIGFYTIFSLPAVLIITIRIAGAAFGEEAVR
GELAKQIGGIIGRSSAQQIQSIVENADQSSATTVGTIIGVSTMIFTATTVFVALQDSLNK
IWEVKAKPERGWVKLVVERVLSLAMVVSLGFLLLVSLAVDVVMGLINDYLREQFSGVAVY
LITAGNVVVSVLISIAIFAAIFKVLPDAKIRWPNVWVGATVTAVLFVLGKYVLNIYFQHN
PLADTYGAAGSLVLILVWVYYASIIFLLGAEFTQVFSREHDRGIQPQDNAVKVETHEVEK
EG