Protein Info for CA264_07845 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 9 to 338 (330 residues), 258.4 bits, E=4e-81
• PF01565: FAD_binding_4
  • amino acids 22 to 152 (131 residues), 68.5 bits, E=5e-23
• PF02873: MurB_C
  • amino acids 215 to 338 (124 residues), 103.8 bits, E=5e-34

Best Hits

Swiss-Prot: 54% identical to MURB_FLAJ1: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 57% identity to dfe:Dfer_3956)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)
• peptidoglycan recycling I (7/14 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

See A0A1X9YR64 at UniProt or InterPro

Protein Sequence (338 amino acids)

>CA264_07845 UDP-N-acetylenolpyruvoylglucosamine reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKLQTNISLKPFNTFGMDAKAKFFARFETVQELQELLQMPELQQEPKLILGGGSNLLLTK
DYEGVVLQNGIKGIVKQREDEDFVYLQAGGGEVWHDFVLHTLRLNLGGIENLSLIPGTVG
AAPLQNIGAYGVELKDVFEELEAVHIETGEVRLFDTSACRFGYRESVFKNDLKGQFIVTH
VTFKLHKHHKPNTSYGAISSTLEEMQVQQPSIQDISAAVCHIRQSKLPDPKQIGNAGSFF
KNPEIQLTQYQALQKQYPAMPSYPVSDTTVKVPAGWLIEQCGWKGKVIGNYGVHKNQALV
LVNYGGARGADIQQLAFDVIQSVEDKFGIRLHPEVNII