Protein Info for CA264_07840 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sodium:proline symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 287 to 318 (32 residues), see Phobius details amino acids 341 to 365 (25 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details amino acids 442 to 462 (21 residues), see Phobius details amino acids 468 to 486 (19 residues), see Phobius details amino acids 525 to 550 (26 residues), see Phobius details amino acids 556 to 574 (19 residues), see Phobius details PF00474: SSF" amino acids 36 to 440 (405 residues), 124.7 bits, see alignment E=2.3e-40

Best Hits

KEGG orthology group: None (inferred from 53% identity to cph:Cpha266_1083)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR62 at UniProt or InterPro

Protein Sequence (582 amino acids)

>CA264_07840 sodium:proline symporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MHLDLIDWIVMGAFALITLVIGISYTGKASGSMANFFLGGRNLPWWIAGTSMVATTFAAD
TPLAVTELVAQSGISGNWLWWNMLLGGLLTTFFFARLWRRAGIITDLEFIELRYSGKPAS
FLRGFRSIYLGIFMNSLIIGWVNVALMSIIEVFFEVPKGEQLIYVGIAMVIVVAYSSMSG
LLGVAITDVIQFVIAIVGCIILAYLVIDSEQIGGIAGLKEKLPPATLDYFPNVGSGSEIG
QTLTLSLGAFLAFTTAQWWASWYPGNEPGGGGYIAQRMMSTKNEKHALYATLFFQIGHYC
IRPWPWILVALAAVVLYPNLGPGNEKLGYVMAMKDFLPPGLKGLLLVAFFAAYMSTISTQ
LNWGASYIINDFYARFIKPDAGQKELVTASRITTLLLMIVSLAVTTQITSIAAVWKFIME
AGAGLGLVLILRWYWWRINAWSEIAATIAPFIGYGVAKYVIGWEFPDSFFLTVGFTTVAW
IVATYVTRPTPKEKLQAFYEKIQPDGAWAPVRKSLGLPKPKTKVYHLLVAWIAAVVMVYS
TLFLIGDLIFQNYPRFAMWLVSAVVALVVMIVMSKRVKFFDD