Protein Info for CA264_07835 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF02926: THUMP" amino acids 36 to 161 (126 residues), 50.5 bits, see alignment E=5e-17 PF01170: UPF0020" amino acids 170 to 376 (207 residues), 161.7 bits, see alignment E=3.7e-51

Best Hits

Swiss-Prot: 42% identical to Y064_SYNY3: Putative RNA methyltransferase slr0064 (slr0064) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K07444, putative N6-adenine-specific DNA methylase [EC: 2.1.1.-] (inferred from 47% identity to zpr:ZPR_1851)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR45 at UniProt or InterPro

Protein Sequence (391 amino acids)

>CA264_07835 RNA methyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAKNISKENFNITVTTLAGLEEVLAEELQALDMEFIKVGNRAVSCSGNLRQLYEANLWCR
TAIRVLKPIRNFKARDEKDLYEQVQKTDWTEIMDLGMTFAIDAVVSHSTFEHSLYVSQLA
KDAIVDQFRKKTGERPSVDRVRPDVRLNLHMHENMVTLSLDSSGDSLHRRGYRLQTNVAP
LNEVLAAGIIALSGWDRKSTFIDPMCGSGTFLIEAALMAQNMAPGLFRRDPYGFEKWKDY
NEALFEMVWTTAEAKAKTVAQAEIIGYDLDADYIEAARGNIENAGLQNIIKLEQANFFQT
SSPSEQGVVVMNPPYNERIQSDDINLLYKNIGDTLKQNYQGYDAFVFTGNLEAAKNVGLR
TSRRVPLYNGSIECRLLKYELYRGSRKGGEK