Protein Info for CA264_07790 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ankryin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF08238: Sel1" amino acids 204 to 233 (30 residues), 17.7 bits, see alignment (E = 1.3e-06) amino acids 237 to 269 (33 residues), 26.1 bits, see alignment (E = 2.9e-09) amino acids 271 to 305 (35 residues), 11.8 bits, see alignment 0.0001 PF13637: Ank_4" amino acids 386 to 420 (35 residues), 28.3 bits, see alignment 5.2e-10 PF12796: Ank_2" amino acids 390 to 460 (71 residues), 27.5 bits, see alignment E=1.2e-09 amino acids 429 to 519 (91 residues), 37.6 bits, see alignment E=7.8e-13 amino acids 472 to 539 (68 residues), 28.2 bits, see alignment E=6.9e-10 PF00023: Ank" amino acids 406 to 448 (43 residues), 19.3 bits, see alignment 3.3e-07 amino acids 488 to 519 (32 residues), 18.1 bits, see alignment (E = 8.1e-07) PF13857: Ank_5" amino acids 474 to 528 (55 residues), 33.3 bits, see alignment 1.5e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYG3 at UniProt or InterPro

Protein Sequence (548 amino acids)

>CA264_07790 ankryin (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKFLLLLLLGGISQVGVAQTAPAKKAAPKTQKAQPAAKKPAAPQAKPVATASAKQLSPA
PAPVIRRVWRTPAMDEAMYYYTSLDFQKAQDKFNEAARQGDHDAYYFLGRMQQYRELKYD
SVVIDTLQQVQHAEKFFAANRDSARYYYQTALDSGSVLGHLGMAELMTLHTEDDKQRFLQ
HMRTAAMVIREKAVEGDAFCNRILGSMYYTGFGELQDYALAHNYLFRAAQANDAVSYTSL
ANLYLNGEGVGKDLEKAVYWLNKGVAAGDREAIYTLALLHEEGTLGEIKIDEARRLYRQA
VAKGSVNAYEQLRYINETPNQKVVVAAVNRDPDMLKRAIAAGGDVNTQAVPNEYDANLQK
RTPLMHAIYVPMLLEGYGVIYEPEVRLKTTSLLLANGADVNAQDLNGQTALHYVVRSSRI
KTEFYEQEQVQLIDTLIANGANPNIKDNEGNTVLAQALHSTIGQHIGILELEKLLQAGAD
PNVQNNAGKTPLMLACEIDANFEIILALLQAGADASLKDSTGKAAIDYTKHENVQNILLA
SGSPRRQQ