Protein Info for CA264_07760 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acetyl-CoA carboxylase biotin carboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit" amino acids 1 to 442 (442 residues), 739.9 bits, see alignment E=5.2e-227 PF00289: Biotin_carb_N" amino acids 1 to 110 (110 residues), 163.3 bits, see alignment E=7.5e-52 PF02655: ATP-grasp_3" amino acids 114 to 294 (181 residues), 25.4 bits, see alignment E=4.3e-09 PF02786: CPSase_L_D2" amino acids 115 to 321 (207 residues), 256.1 bits, see alignment E=6.9e-80 PF02222: ATP-grasp" amino acids 138 to 292 (155 residues), 34.1 bits, see alignment E=6.2e-12 PF07478: Dala_Dala_lig_C" amino acids 145 to 291 (147 residues), 36.9 bits, see alignment E=8.6e-13 PF02785: Biotin_carb_C" amino acids 334 to 440 (107 residues), 149.7 bits, see alignment E=9.2e-48

Best Hits

Swiss-Prot: 60% identical to ACCC_ARATH: Biotin carboxylase, chloroplastic (CAC2) from Arabidopsis thaliana

KEGG orthology group: K01961, acetyl-CoA carboxylase, biotin carboxylase subunit [EC: 6.3.4.14 6.4.1.2] (inferred from 80% identity to dfe:Dfer_4148)

MetaCyc: 60% identical to biotin carboxylase (Arabidopsis thaliana col)
Biotin carboxylase. [EC: 6.3.4.14]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.14, 6.4.1.2

Use Curated BLAST to search for 6.3.4.14 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR48 at UniProt or InterPro

Protein Sequence (448 amino acids)

>CA264_07760 acetyl-CoA carboxylase biotin carboxylase subunit (Pontibacter actiniarum KMM 6156, DSM 19842)
MFKKILIANRGEIALRIIRTCKEMGIKTVAVYSTADKESLHVRFADEAVCIGPAPSAQSY
LNIPNIIAAAEITNADAIHPGYGFLSENAEFSRICAENGIKFIGASPEMINQMGDKASAK
DTMKKAGVPTIPGSDGLLKSVEEGLKIASKIQYPVILKATAGGGGRGMRIVKDASEFEKA
WNDARTESKAAFGNDGLYLEKFVVEPRHIEIQLIGDQHGQVAHLSERDCSIQRRHQKLVE
ETPSPFITDELREKMGQAAIAGAKAINYEGVGTIEFLVDKNRDFYFMEMNTRIQVEHPIT
EEVIDYDLIKEQIKVAAGHKITGKNYYPKMHAIECRINAEDPKNNFRPSPGKITTLHTPG
GHGVRVDSHVYSGYIIPPNYDSMIAKLIVSAQTREEALVKMKRALSEFVIEGIKTTVPFH
LKLMDDPGFKEGNFTTKYLEDFDFGAIE