Protein Info for CA264_07755 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein
  • amino acids 1 to 161 (161 residues), 173.9 bits, E=1.6e-55
• PF00364: Biotin_lipoyl
  • amino acids 87 to 158 (72 residues), 84.1 bits, E=4.9e-28

Best Hits

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 71% identity to mtt:Ftrac_3201)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)

Sequence Analysis Tools

See A0A1X9YR67 at UniProt or InterPro

Protein Sequence (163 amino acids)

>CA264_07755 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit (Pontibacter actiniarum KMM 6156, DSM 19842)
MKAKEIQDLIDFIAKSGLNKVNIETEEFKISVKRDPDQKVTYVKDSGAAHAAAPAPVAAP
QAAPAPAAAPAPAAAPAPASDDSKYVAIKAPMIGTFYRASSPDTPVFVNVGDEVKKGQVI
CIIEAMKLFNEIESEVSGKIVKVLVDNASPVEYDQPLFLVDPS