Protein Info for CA264_07750 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF08207: EFP_N" amino acids 3 to 60 (58 residues), 92.2 bits, see alignment E=2.4e-30 TIGR00038: translation elongation factor P" amino acids 3 to 186 (184 residues), 227 bits, see alignment E=7.3e-72 PF01132: EFP" amino acids 68 to 117 (50 residues), 49.6 bits, see alignment E=4.7e-17 PF09285: Elong-fact-P_C" amino acids 130 to 185 (56 residues), 94.2 bits, see alignment E=4.7e-31

Best Hits

Swiss-Prot: 64% identical to EFP_AMOA5: Elongation factor P (efp) from Amoebophilus asiaticus (strain 5a2)

KEGG orthology group: K02356, elongation factor P (inferred from 74% identity to mtt:Ftrac_3200)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR38 at UniProt or InterPro

Protein Sequence (187 amino acids)

>CA264_07750 elongation factor P (Pontibacter actiniarum KMM 6156, DSM 19842)
MATTADIKNGVVLEYNNDLYVVTDFQHVKPGKGPAFVRTKLKNVRTGKVLDNTFSAGHKI
TTARVEQRPHQFIFKDDLGYHFMDLNTFEQVSLEDAMVPFADLMKEGQEVTILFHAETET
PLTCEIPPFVELTITYTEPGLKGDTATNASKPAIVETGATIQVPLFIGQDEKIKVDTRTY
SYAERVK