Protein Info for CA264_07720 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: gamma-glutamyl-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00407: glutamate-5-semialdehyde dehydrogenase
  • amino acids 11 to 404 (394 residues), 439 bits, E=7.3e-136
• PF00171: Aldedh
  • amino acids 34 to 267 (234 residues), 29.2 bits, E=1.9e-11

Best Hits

Swiss-Prot: 64% identical to PROA_BACTN: Gamma-glutamyl phosphate reductase (proA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 68% identity to cts:Ctha_1455)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (3/3 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-N^δ-acetylornithine biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

See A0A1X9YR26 at UniProt or InterPro

Protein Sequence (415 amino acids)

>CA264_07720 gamma-glutamyl-phosphate reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MALQQVFNSVKQASRKLNLLSEDKVKQVLEDLAAKAVAATGTILAANQQDLDRMETSDPK
YDRLKLTEERIEGIAADIRNVASLPSPLGKVLSERHLDNGLEMKKVSVPLGVIGIIYEAR
PNVTFDVFSLCLRSGNALLLKGGSDAKDSNAAIVQLIHEVLEQNGVDKNIVQLLPPDRSS
TQEMLHAVGYVDIIIPRGSQGLINYVRENSKVPVIETGAGIVHTYFDEFADLASGKDIVV
NAKTRRVSVCNALDCLVIHEDRLPDLAEIGKGLAEKGVELFADAPAYAALKDTYPSEKLQ
EATEEHFGTEFLSLKLAVKTVGGLEEAIAHINANTSQHSEAIISENEAHVDHFLKAVDAA
AVYANTSTAFTDGAQFGLGAEIGISTQKLHARGPMALDELTSYKWVVKGKGQIRA