Protein Info for CA264_07675 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 31 to 57 (27 residues), see Phobius details amino acids 64 to 64 (1 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details amino acids 289 to 316 (28 residues), see Phobius details amino acids 331 to 355 (25 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details amino acids 407 to 428 (22 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details PF01554: MatE" amino acids 37 to 197 (161 residues), 110.6 bits, see alignment E=6.6e-36 amino acids 272 to 423 (152 residues), 104.3 bits, see alignment E=5.6e-34 TIGR00797: MATE efflux family protein" amino acids 37 to 435 (399 residues), 262.7 bits, see alignment E=2.8e-82

Best Hits

KEGG orthology group: None (inferred from 52% identity to cpi:Cpin_0545)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR16 at UniProt or InterPro

Protein Sequence (464 amino acids)

>CA264_07675 MATE family efflux transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MPKLQDFPQLVWAAIKGKEQDYTMLGIKHSIILLAIPMILEMMMESLFAIVDIFFVGKLG
ANALATVGLTESVLMIIYAVGMGISIAATAMVSRRVGEKNYSEAGSITFQLIVTGVALAL
LMGGLATFFAAETLALLGAAPEVIATGVTYAQIIFAGNVAIILLFLINGAFRGAGQPHLA
MRALWLANGANIILDPLLIFGLGSIEGLGLAGAAWATTIGRSIGVLYQLYHLFNGKHLLK
LTRENMVLSVGVIIRILKLASGGVGQYLIDSASWIFLTRLMAEFGSSALAGYTVAFRIIM
FTLLPAWGLSSAAATLVGQNLGAQKAKRAELAVWLTARYNMVFMAAVTLVFILFGEHLSD
FFTDEAVVISVATEALQIITLGYVFFGLGMVMVQAFNGAGDTRTPAAINVVVLWLIEIPL
AYLLALYFHFGATGIFIAIAFCHSFHALVSGWLFRRGTWKRIKV