Protein Info for CA264_07540 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 335 to 362 (28 residues), see Phobius details amino acids 382 to 407 (26 residues), see Phobius details amino acids 428 to 451 (24 residues), see Phobius details amino acids 677 to 702 (26 residues), see Phobius details amino acids 729 to 749 (21 residues), see Phobius details amino acids 761 to 781 (21 residues), see Phobius details PF12704: MacB_PCD" amino acids 20 to 243 (224 residues), 77.9 bits, see alignment E=1.4e-25 PF02687: FtsX" amino acids 294 to 409 (116 residues), 65.9 bits, see alignment E=3.5e-22 amino acids 680 to 783 (104 residues), 39.1 bits, see alignment E=6.8e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXZ7 at UniProt or InterPro

Protein Sequence (800 amino acids)

>CA264_07540 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MIKMYFLTAFRSLVRNKSYSLLNIAGLALGITCSILLFLVIQYQLSYDDFHQKADRIYRL
NVDFVGRDFHTPASHYPLPAYMRTNDRLGFDAVTQIQGTAGAQINVPADGTRPARKFLED
SSVGFVDAEFFEVFDFNTGPLDLRAYFKEPNVVVLEQATADKFFPGENAVGKVIRYNNMY
NLRVVSVMPDMPGNTEFPFSMLISYPTIQNSLPDDWGNLSSDHQTFVVLPEHMSAGTAAE
AVNSFVAQQVEDENPNRQAVYSLQPLRDIHYNTDYFGAYAQTPITKEMIMAMAAVAVIIL
LTACINFINLATAQATKRAKEVGVRKVLGSSQWQLVLQFLCETLFLVMFATFISVILVEL
ALPYLNELLELEIAFSLLQDPLMLLFLFLQVLLVTLFAGFYPAFVLSNFKPITALKSRMS
VQRLGGVSLRQVLVVLQFTICQVLIICTFLVSEQMAFFRSKPLGFNKEAVVVVKLPQQTN
QRIQPLRQELLNNPAVKNVSFASDAPSSGNMSYGNFYFNHAAEDEDFQTHKKYADAQYFD
LFDLKFVAGKPYTNDSLQYMVINDTMRRRLGLKTPEEAIGKHISFGGDGQFAGAIAGVVA
DFHQASLALPIEPLLITKYPQGYGTLSAKIDMNQKQEALQHLEKVWEKAYPNDVFSYYFF
DESIAEFYKDEARQNVLFKVFSLITILIGCLGLYGLVAFMAAQRTKEVGIRKVMGASIFN
IAVLFSKEFIKLVLLAFVLAAPIAYYIISHWLEDYTYRISIGYWPFILAGLATLTIALVT
MGSKAVQAALSNPVLSLKSE