Protein Info for CA264_07495 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: GTP-binding protein YchF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00092: GTP-binding protein YchF
  • amino acids 1 to 365 (365 residues), 511.6 bits, E=6.4e-158
• PF01926: MMR_HSR1
  • amino acids 4 to 123 (120 residues), 85 bits, E=6e-28
• PF02421: FeoB_N
  • amino acids 5 to 54 (50 residues), 35.5 bits, 1.1e-12
• PF06071: YchF-GTPase_C
  • amino acids 281 to 364 (84 residues), 139.9 bits, E=3.5e-45

Best Hits

Swiss-Prot: 61% identical to YCHF_PASMU: Ribosome-binding ATPase YchF (ychF) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K06942, (no description) (inferred from 76% identity to chu:CHU_2219)

MetaCyc: 60% identical to redox-responsive ATPase YchF (Escherichia coli K-12 substr. MG1655)
Nucleoside-triphosphatase. [EC: 3.6.1.15, 3.6.1.5]

Predicted SEED Role

"GTP-binding and nucleic acid-binding protein YchF" in subsystem Universal GTPases

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.15

Use Curated BLAST to search for 3.6.1.15 or 3.6.1.5

Sequence Analysis Tools

See A0A1X9YQY5 at UniProt or InterPro

Protein Sequence (365 amino acids)

>CA264_07495 GTP-binding protein YchF (Pontibacter actiniarum KMM 6156, DSM 19842)
MGLRCGIVGLPNVGKSTLFNAISNAKAESANYPFCTIEPNVGVITVPDERLQILEELVHP
ERVLPTVIEFVDIAGLVKGASKGEGLGNKFLANIREVDAIIHVVRCFEDENIVHVDGKVN
PIADKEIIDTELQLKDLESIDKKILKVVRSAKSGDAKAKKELASLEKYKAHLEAGLNARS
LDVTEDDLEAVEDLKLLTAKPVIYAANVDENSMLEGNQYSEALREHVKDENALVVLISAS
IEAQIAELTDPEEKEMFLSEYGLKESGLNKLIRASYDLLNLITYFTAGVKEVRAWTIEKG
WKAPQAAGVIHTDFEKGFIRAEVIKLKDYQEYKSEAKIKEAGKMAVEGKEYVVQDGDIMH
FRFNV